CAPZA1 (NM_006135) Human Recombinant Protein

CAT#: TP301642

Recombinant protein of human capping protein (actin filament) muscle Z-line, alpha 1 (CAPZA1)

Product Images

Coomassie blue staining of purified CAPZA1 protein (Cat# TP301642). The protein was produced from HEK293T cells transfected with CAPZA1 cDNA clone (Cat# RC201642) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201642 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MADFDDRVSDEEKVRIAAKFITHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNMDQFTPVKIEGY
  EDQVLITEHGDLGNSRFLDPRNKISFKFDHLRKEASDPQPEEADGGLKSWRESCDSALRAYVKDHYSNGF
  CTVYAKTIDGQQTIIACIESHQFQPKNFWNGRWRSEWKFTITPPTAQVVGVLKIQVHYYEDGNVQLVSHK
  DVQDSLTVSNEAQTAKEFIKIIENAENEYQTAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIG
  KEMQNA
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 32.7 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_006126
• Locus ID: 829
• UniProt ID: P52907
• Cytogenetics: 1p13.2
• Refseq Size: 2758
• Refseq ORF: 858
• Synonyms: CAPPA1; CAPZ; CAZ1
• Summary: CAPZA1 is a member of the F-actin capping protein alpha subunit family. This gene encodes the alpha subunit of the barbed-end actin binding protein. The protein regulates growth of the actin filament by capping the barbed end of growing actin filaments. [provided by RefSeq, Jul 2008]