Thioredoxin 2 (TXN2) (NM_012473) Human Mass Spec Standard

CAT#: PH301666

TXN2 MS Standard C13 and N15-labeled recombinant protein (NP_036605)

Product Images

Coomassie blue staining of purified TXN2 protein (Cat# TP301666). The protein was produced from HEK293T cells transfected with TXN2 cDNA clone (Cat# RC201666) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201666
• Predicted MW: 18.4 kDa
• Protein Sequence:
  Sequence Link

  >RC201666 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAQRLLLRRFLASVISRKPSQGQWPPLTSRALQTPQCSPGGLTVTPNPARTIYTTRISLTTFNIQDGPDF
  QDRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMK
  NGDVVDKFVGIKDEDQLEAFLKKLIG
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_036605
• RefSeq Size: 1342
• RefSeq ORF: 498
• Synonyms: COXPD29; MT-TRX; MTRX; TRX2; TXN
• Locus ID: 25828
• UniProt ID: Q99757
• Cytogenetics: 22q12.3
• Summary: This nuclear gene encodes a mitochondrial member of the thioredoxin family, a group of small multifunctional redox-active proteins. The encoded protein may play important roles in the regulation of the mitochondrial membrane potential and in protection against oxidant-induced apoptosis. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome