EIF3F (NM_003754) Human Mass Spec Standard

CAT#: PH301740

EIF3F MS Standard C13 and N15-labeled recombinant protein (NP_003745)

Product Images

Coomassie blue staining of purified EIF3F protein (Cat# TP301740). The protein was produced from HEK293T cells transfected with EIF3F cDNA clone (Cat# RC201740) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201740
• Predicted MW: 37.4 kDa
• Protein Sequence:
  Sequence Link

  >RC201740 representing NM_003754
  Red=Cloning site Green=Tags(s)
  
  MATPAVPVSAPPATPTPVPAAAPASVPAPTPAPAAAPVPAAAPASSSDPAAAAAATAAPGQTPASAQAPA
  QTPAPALPGPALPGPFPGGRVVRLHPVILASIVDSYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHN
  ESEDEVAVDMEFAKNMYELHKKVSPNELILGWYATGHDITEHSVLIHEYYSREAPNPIHLTVDTSLQNGR
  MSIKAYVSTLMGVPGRTMGVMFTPLTVKYAYYDTERIGVDLIMKTCFSPNRVIGLSSDLQQVGGASARIQ
  DALSTVLQYAEDVLSGKVSADNTVGRFLMSLVNQVPKIVPDDFETMLNSNINDLLMVTYLANLTQSQIAL
  NEKLVNL
  
  SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003745
• RefSeq Size: 1274
• RefSeq ORF: 1071
• Synonyms: eIF3-p47; EIF3S5; MRT67
• Locus ID: 8665
• UniProt ID: O00303
• Cytogenetics: 11p15.4
• Protein Families: Druggable Genome