Nucleobindin 1 (NUCB1) (NM_006184) Human Mass Spec Standard

CAT#: PH301786

NUCB1 MS Standard C13 and N15-labeled recombinant protein (NP_006175)

Product Images

Coomassie blue staining of purified NUCB1 protein (Cat# TP301786). The protein was produced from HEK293T cells transfected with NUCB1 cDNA clone (Cat# RC201786) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201786
• Predicted MW: 53.9 kDa
• Protein Sequence:
  Sequence Link

  >RC201786 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPPSGPRGTLLLLPLLLLLLLRAVLAVPLERGAPNKEETPATESPDTGLYYHRYLQEVIDVLETDGHFRE
  KLQAANAEDIKSGKLSRELDFVSHHVRTKLDELKRQEVSRLRMLLKAKMDAEQDPNVQVDHLNLLKQFEH
  LDPQNQHTFEARDLELLIQTATRDLAQYDAAHHEEFKRYEMLKEHERRRYLESLGEEQRKEAERKLEEQQ
  RRHREHPKVNVPGSQAQLKEVWEELDGLDPNRFNPKTFFILHDINSDGVLDEQELEALFTKELEKVYDPK
  NEEDDMREMEEERLRMREHVMKNVDTNQDRLVTLEEFLASTQRKEFGDTGEGWETVEMHPAYTEEELRRF
  EEELAAREAELNAKAQRLSQETEALGRSQGRLEAQKRELQQAVLHMEQRKQQQQQQQGHKAPAAHPEGQL
  KFHPDTDDVPVPAPAGDQKEVDTSEKKLLERLPEVEVPQHL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006175
• RefSeq Size: 2585
• RefSeq ORF: 1383
• Synonyms: CALNUC; NUC
• Locus ID: 4924
• UniProt ID: Q02818, A8K7Q1
• Cytogenetics: 19q13.33
• Summary: 'This gene encodes a member of a small calcium-binding EF-hand protein family. The encoded protein is thought to have a key role in Golgi calcium homeostasis and Ca(2+)-regulated signal transduction events. [provided by RefSeq, Jun 2010]'