PGRMC1 (NM_006667) Human Mass Spec Standard
CAT#: PH301918
PGRMC1 MS Standard C13 and N15-labeled recombinant protein (NP_006658)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201918 |
Predicted MW | 21.7 kDa |
Protein Sequence |
>RC201918 protein sequence
Red=Cloning site Green=Tags(s) MAAEDVVATGADPSDLESGGLLHEIFTSPLNLLLLGLCIFLLYKIVRGDQPAASGDSDDDEPPPLPRLKR RDFTPAELRRFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASRGLATFCLDKEALKDEYD DLSDLTAAQQETLSDWESQFTFKYHHVGKLLKEGEEPTVYSDEEEPKDESARKND myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_006658 |
RefSeq Size | 1931 |
RefSeq ORF | 585 |
Synonyms | Dap1; HPR6.6; IZA; MPR |
Locus ID | 10857 |
UniProt ID | O00264, Q6IB11 |
Cytogenetics | Xq24 |
Summary | This gene encodes a putative membrane-associated progesterone steroid receptor. The protein is expressed predominantly in the liver and kidney. [provided by RefSeq, Mar 2010] |
Protein Families | Druggable Genome, Nuclear Hormone Receptor, Transmembrane |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401994 | PGRMC1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY401994 | Transient overexpression lysate of progesterone receptor membrane component 1 (PGRMC1) |
USD 325.00 |
|
TP301918 | Recombinant protein of human progesterone receptor membrane component 1 (PGRMC1) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review