PGRMC1 (NM_006667) Human Mass Spec Standard

CAT#: PH301918

PGRMC1 MS Standard C13 and N15-labeled recombinant protein (NP_006658)

Product Images

Coomassie blue staining of purified PGRMC1 protein (Cat# TP301918). The protein was produced from HEK293T cells transfected with PGRMC1 cDNA clone (Cat# RC201918) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201918
• Predicted MW: 21.7 kDa
• Protein Sequence:
  Sequence Link

  >RC201918 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAEDVVATGADPSDLESGGLLHEIFTSPLNLLLLGLCIFLLYKIVRGDQPAASGDSDDDEPPPLPRLKR
  RDFTPAELRRFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASRGLATFCLDKEALKDEYD
  DLSDLTAAQQETLSDWESQFTFKYHHVGKLLKEGEEPTVYSDEEEPKDESARKND
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006658
• RefSeq Size: 1931
• RefSeq ORF: 585
• Synonyms: Dap1; HPR6.6; IZA; MPR
• Locus ID: 10857
• UniProt ID: O00264, Q6IB11
• Cytogenetics: Xq24
• Summary: This gene encodes a putative membrane-associated progesterone steroid receptor. The protein is expressed predominantly in the liver and kidney. [provided by RefSeq, Mar 2010]
• Protein Families: Druggable Genome, Nuclear Hormone Receptor, Transmembrane