PGRMC1 (NM_006667) Human Recombinant Protein

CAT#: TP301918

Recombinant protein of human progesterone receptor membrane component 1 (PGRMC1)

Product Images

Coomassie blue staining of purified PGRMC1 protein (Cat# TP301918). The protein was produced from HEK293T cells transfected with PGRMC1 cDNA clone (Cat# RC201918) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201918 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAEDVVATGADPSDLESGGLLHEIFTSPLNLLLLGLCIFLLYKIVRGDQPAASGDSDDDEPPPLPRLKR
  RDFTPAELRRFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASRGLATFCLDKEALKDEYD
  DLSDLTAAQQETLSDWESQFTFKYHHVGKLLKEGEEPTVYSDEEEPKDESARKND
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 21.5 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_006658
• Locus ID: 10857
• UniProt ID: O00264, Q6IB11
• Cytogenetics: Xq24
• Refseq Size: 1931
• Refseq ORF: 585
• Synonyms: Dap1; HPR6.6; IZA; MPR
• Summary: This gene encodes a putative membrane-associated progesterone steroid receptor. The protein is expressed predominantly in the liver and kidney. [provided by RefSeq, Mar 2010]
• Protein Families: Druggable Genome, Nuclear Hormone Receptor, Transmembrane