Josephin 1 (JOSD1) (NM_014876) Human Mass Spec Standard

CAT#: PH301968

JOSD1 MS Standard C13 and N15-labeled recombinant protein (NP_055691)

Product Images

Coomassie blue staining of purified JOSD1 protein (Cat# TP301968). The protein was produced from HEK293T cells transfected with JOSD1 cDNA clone (Cat# RC201968) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201968
• Predicted MW: 23.2 kDa
• Protein Sequence:
  Sequence Link

  >RC201968 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSCVPWKGDKAKSESLELPQAAPPQIYHEKQRRELCALHALNNVFQDSNAFTRDTLQEIFQRLSPNTMVT
  PHKKSMLGNGNYDVNVIMAALQTKGYEAVWWDKRRDVGVIALTNVMGFIMNLPSSLCWGPLKLPLKRQHW
  ICVREVGGAYYNLDSKLKMPEWIGGESELRKFLKHHLRGKNCELLLVVPEEVEAHQSWRTDV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_055691
• RefSeq Size: 3435
• RefSeq ORF: 606
• Synonyms: dJ508I15.2
• Locus ID: 9929
• UniProt ID: Q15040, A0A024R1P5
• Cytogenetics: 22q13.1
• Summary: Deubiquitinates monoubiquitinated probes (in vitro). When ubiquitinated, cleaves 'Lys-63'-linked and 'Lys-48'-linked poly-ubiquitin chains (in vitro), hence may act as a deubiquitinating enzyme. May increase macropinocytosis and suppress clathrin- and caveolae-mediated endocytosis. May enhance membrane dynamics and cell motility independently of its catalytic activity. [UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome