ETS1 associated protein II (TDP2) (NM_016614) Human Mass Spec Standard

CAT#: PH302015

TTRAP MS Standard C13 and N15-labeled recombinant protein (NP_057698)

Product Images

Coomassie blue staining of purified TDP2 protein (Cat# TP302015). The protein was produced from HEK293T cells transfected with TDP2 cDNA clone (Cat# RC202015) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202015
• Predicted MW: 40.9 kDa
• Protein Sequence:
  Sequence Link

  >RC202015 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MELGSCLEGGREAAEEEGEPEVKKRRLLCVEFASVASCDAAVAQCFLAENDWEMERALNSYFEPPVEESA
  LERRPETISEPKTYVDLTNEETTDSTTSKISPSEDTQQENGSMFSLITWNIDGLDLNNLSERARGVCSYL
  ALYSPDVIFLQEVIPPYYSYLKKRSSNYEIITGHEEGYFTAIMLKKSRVKLKSQEIIPFPSTKMMRNLLC
  VHVNVSGNELCLMTSHLESTRGHAAERMNQLKMVLKKMQEAPESATVIFAGDTNLRDREVTRCGGLPNNI
  VDVWEFLGKPKHCQYTWDTQMNSNLGITAACKLRFDRIFFRAAAEEGHIIPRSLDLLGLEKLDCGRFPSD
  HWGLLCNLDIIL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057698
• RefSeq Size: 1940
• RefSeq ORF: 1086
• Synonyms: AD022; dJ30M3.3; EAP2; EAPII; hTDP2; TTRAP
• Locus ID: 51567
• UniProt ID: O95551, A0A384MDM5
• Cytogenetics: 6p22.3
• Summary: This gene encodes a member of a superfamily of divalent cation-dependent phosphodiesterases. The encoded protein associates with CD40, tumor necrosis factor (TNF) receptor-75 and TNF receptor associated factors (TRAFs), and inhibits nuclear factor-kappa-B activation. This protein has sequence and structural similarities with APE1 endonuclease, which is involved in both DNA repair and the activation of transcription factors. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Stem cell - Pluripotency, Transcription Factors