S100A3 (NM_002960) Human Mass Spec Standard

CAT#: PH302117

S100A3 MS Standard C13 and N15-labeled recombinant protein (NP_002951)

Product Images

Coomassie blue staining of purified S100A3 protein (Cat# TP302117). The protein was produced from HEK293T cells transfected with S100A3 cDNA clone (Cat# RC202117) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202117
• Predicted MW: 11.7 kDa
• Protein Sequence:
  Sequence Link

  >RC202117 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMSVLDTNKDCEV
  DFVEYVRSLACLCLYCHEYFKDCPSEPPCSQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002951
• RefSeq Size: 738
• RefSeq ORF: 303
• Synonyms: S100E
• Locus ID: 6274
• UniProt ID: P33764
• Cytogenetics: 1q21.3
• Summary: 'The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein has the highest content of cysteines of all S100 proteins, has a high affinity for Zinc, and is highly expressed in human hair cuticle. The precise function of this protein is unknown. [provided by RefSeq, Jul 2008]'