S100A3 (NM_002960) Human Recombinant Protein

CAT#: TP302117

Recombinant protein of human S100 calcium binding protein A3 (S100A3)

Product Images

Coomassie blue staining of purified S100A3 protein (Cat# TP302117). The protein was produced from HEK293T cells transfected with S100A3 cDNA clone (Cat# RC202117) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202117 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMSVLDTNKDCEV
  DFVEYVRSLACLCLYCHEYFKDCPSEPPCSQ
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 11.5 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_002951
• Locus ID: 6274
• UniProt ID: P33764
• Cytogenetics: 1q21.3
• Refseq Size: 738
• Refseq ORF: 303
• Synonyms: S100E
• Summary: The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein has the highest content of cysteines of all S100 proteins, has a high affinity for Zinc, and is highly expressed in human hair cuticle. The precise function of this protein is unknown. [provided by RefSeq, Jul 2008]