GSTA4 (NM_001512) Human Mass Spec Standard
CAT#: PH302130
GSTA4 MS Standard C13 and N15-labeled recombinant protein (NP_001503)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202130 |
Predicted MW | 25.7 kDa |
Protein Sequence |
>RC202130 protein sequence
Red=Cloning site Green=Tags(s) MAARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEIDGMKLVQTRS ILHYIADKHNLFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKEVVNMAQKAIIRYFPVFEKIL RGHGQSFLVGNQLSLADVILLQTILALEEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDE IYVRTVYNIFRP myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001503 |
RefSeq Size | 1352 |
RefSeq ORF | 666 |
Synonyms | GSTA4-4; GTA4 |
Locus ID | 2941 |
UniProt ID | O15217, A0A024RD58 |
Cytogenetics | 6p12.2 |
Summary | 'Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-tranferase belonging to the alpha class. The alpha class genes, which are located in a cluster on chromosome 6, are highly related and encode enzymes with glutathione peroxidase activity that function in the detoxification of lipid peroxidation products. Reactive electrophiles produced by oxidative metabolism have been linked to a number of degenerative diseases including Parkinson's disease, Alzheimer's disease, cataract formation, and atherosclerosis. [provided by RefSeq, Jul 2008]' |
Protein Pathways | Drug metabolism - cytochrome P450, Glutathione metabolism, Metabolism of xenobiotics by cytochrome P450 |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400591 | GSTA4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY400591 | Transient overexpression lysate of glutathione S-transferase alpha 4 (GSTA4) |
USD 325.00 |
|
TP302130 | Recombinant protein of human glutathione S-transferase alpha 4 (GSTA4) |
USD 823.00 |
|
TP790105 | Purified recombinant protein of Human glutathione S-transferase alpha 4 (GSTA4), full length, with C-terminal DDK tag,expressed in CHO cells; |
USD 719.00 |
{0} Product Review(s)
Be the first one to submit a review