RAB39B (NM_171998) Human Mass Spec Standard

CAT#: PH302178

RAB39B MS Standard C13 and N15-labeled recombinant protein (NP_741995)

Product Images

Coomassie blue staining of purified RAB39B protein (Cat# TP302178). The protein was produced from HEK293T cells transfected with RAB39B cDNA clone (Cat# RC202178) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202178
• Predicted MW: 24.6 kDa
• Protein Sequence:
  Sequence Link

  >RC202178 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLVEIEPGKRIKLQIWDTAGQER
  FRSITRAYYRNSVGGLLLFDITNRRSFQNVHEWLEETKVHVQPYQIVFVLVGHKCDLDTQRQVTRHEAEK
  LAAAYGMKYIETSARDAINVEKAFTDLTRDIYELVKRGEITIQEGWEGVKSGFVPNVVHSSEEVVKSERR
  CLC
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_741995
• RefSeq Size: 3512
• RefSeq ORF: 639
• Synonyms: BGMR; MRX72; WSMN; WSN
• Locus ID: 116442
• UniProt ID: Q96DA2
• Cytogenetics: Xq28
• Summary: This gene encodes a member of the Rab family of proteins. Rab proteins are small GTPases that are involved in vesicular trafficking. Mutations in this gene are associated with X-linked cognitive disability. [provided by RefSeq, Aug 2013]
• Protein Families: Druggable Genome