RAB39B (NM_171998) Human Recombinant Protein

CAT#: TP302178

Recombinant protein of human RAB39B, member RAS oncogene family (RAB39B)

Product Images

Coomassie blue staining of purified RAB39B protein (Cat# TP302178). The protein was produced from HEK293T cells transfected with RAB39B cDNA clone (Cat# RC202178) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202178 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLVEIEPGKRIKLQIWDTAGQER
  FRSITRAYYRNSVGGLLLFDITNRRSFQNVHEWLEETKVHVQPYQIVFVLVGHKCDLDTQRQVTRHEAEK
  LAAAYGMKYIETSARDAINVEKAFTDLTRDIYELVKRGEITIQEGWEGVKSGFVPNVVHSSEEVVKSERR
  CLC
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 24.4 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_741995
• Locus ID: 116442
• UniProt ID: Q96DA2
• Cytogenetics: Xq28
• Refseq Size: 3512
• Refseq ORF: 639
• Synonyms: BGMR; MRX72; WSMN; WSN
• Summary: This gene encodes a member of the Rab family of proteins. Rab proteins are small GTPases that are involved in vesicular trafficking. Mutations in this gene are associated with X-linked cognitive disability. [provided by RefSeq, Aug 2013]
• Protein Families: Druggable Genome