FKBP25 (FKBP3) (NM_002013) Human Mass Spec Standard

CAT#: PH302200

FKBP3 MS Standard C13 and N15-labeled recombinant protein (NP_002004)

Product Images

Coomassie blue staining of purified FKBP3 protein (Cat# TP302200). The protein was produced from HEK293T cells transfected with FKBP3 cDNA clone (Cat# RC202200) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202200
• Predicted MW: 25.2 kDa
• Protein Sequence:
  Sequence Link

  >RC202200 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAAVPQRAWTVEQLRSEQLPKKDIIKFLQEHGSDSFLAEHKLLGNIKNVAKTANKDHLVTAYNHLFETK
  RFKGTESISKVSEQVKNVKLNEDKPKETKSEETLDEGPPKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQ
  DGTVFDTNIQTSAKKKKNAKPLSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPP
  NAKLTFEVELVDID
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002004
• RefSeq Size: 1353
• RefSeq ORF: 672
• Synonyms: FKBP-3; FKBP-25; FKBP25; PPIase
• Locus ID: 2287
• UniProt ID: Q00688
• Cytogenetics: 14q21.2
• Summary: 'The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin, as well as histone deacetylases, the transcription factor YY1, casein kinase II, and nucleolin. It has a higher affinity for rapamycin than for FK506 and thus may be an important target molecule for immunosuppression by rapamycin. [provided by RefSeq, Sep 2008]'
• Protein Families: Druggable Genome, Stem cell - Pluripotency