Endothelin 1 (EDN1) (NM_001955) Human Mass Spec Standard

CAT#: PH302217

EDN1 MS Standard C13 and N15-labeled recombinant protein (NP_001946)

Product Images

Coomassie blue staining of purified EDN1 protein (Cat# TP302217). The protein was produced from HEK293T cells transfected with EDN1 cDNA clone (Cat# RC202217) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202217
• Predicted MW: 24.4 kDa
• Protein Sequence:
  Sequence Link

  >RC202217 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDYLLMIFSLLFVACQGAPETAVLGAELSAVGENGGEKPTPSPPWRLRRSKRCSCSSLMDKECVYFCHLD
  IIWVNTPEHVVPYGLGSPRSKRALENLLPTKATDRENRCQCASQKDKKCWNFCQAGKELRAEDIMEKDWN
  NHKKGKDCSKLGKKCIYQQLVRGRKIRRSSEEHLRQTRSETMRNSVKSSFHDPKLKGNPSRERYVTHNRA
  HW
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001946
• RefSeq Size: 2112
• RefSeq ORF: 636
• Synonyms: ARCND3; ET1; HDLCQ7; PPET1; QME
• Locus ID: 1906
• UniProt ID: P05305, Q6FH53
• Cytogenetics: 6p24.1
• Summary: 'This gene encodes a preproprotein that is proteolytically processed to generate a secreted peptide that belongs to the endothelin/sarafotoxin family. This peptide is a potent vasoconstrictor and its cognate receptors are therapeutic targets in the treatment of pulmonary arterial hypertension. Aberrant expression of this gene may promote tumorigenesis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2015]'
• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Melanogenesis