Endothelin 1 (EDN1) (NM_001955) Human Recombinant Protein

CAT#: TP302217

Recombinant protein of human endothelin 1 (EDN1)

Product Images

Coomassie blue staining of purified EDN1 protein (Cat# TP302217). The protein was produced from HEK293T cells transfected with EDN1 cDNA clone (Cat# RC202217) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202217 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDYLLMIFSLLFVACQGAPETAVLGAELSAVGENGGEKPTPSPPWRLRRSKRCSCSSLMDKECVYFCHLD
  IIWVNTPEHVVPYGLGSPRSKRALENLLPTKATDRENRCQCASQKDKKCWNFCQAGKELRAEDIMEKDWN
  NHKKGKDCSKLGKKCIYQQLVRGRKIRRSSEEHLRQTRSETMRNSVKSSFHDPKLKGNPSRERYVTHNRA
  HW
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 22.4 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001946
• Locus ID: 1906
• UniProt ID: P05305, Q6FH53
• Cytogenetics: 6p24.1
• Refseq Size: 2112
• Refseq ORF: 636
• Synonyms: ARCND3; ET1; HDLCQ7; PPET1; QME
• Summary: This gene encodes a preproprotein that is proteolytically processed to generate a secreted peptide that belongs to the endothelin/sarafotoxin family. This peptide is a potent vasoconstrictor and its cognate receptors are therapeutic targets in the treatment of pulmonary arterial hypertension. Aberrant expression of this gene may promote tumorigenesis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2015]
• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Melanogenesis