PBLD (NM_022129) Human Mass Spec Standard

CAT#: PH302328

PBLD MS Standard C13 and N15-labeled recombinant protein (NP_071412)

Product Images

Coomassie blue staining of purified PBLD protein (Cat# TP302328). The protein was produced from HEK293T cells transfected with PBLD cDNA clone (Cat# RC202328) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202328
• Predicted MW: 31.8 kDa
• Protein Sequence:
  Sequence Link

  >RC202328 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKLPIFIADAFTARAFRGNPAAVCLLENELDEDMHQKIAREMNLSETAFIRKLHPTDNFAQSSCFGLRWF
  TPASEVPLCGHATLASAAVLFHKIKNMNSTLTFVTLSGELRARRAEDGIVLDLPLYPAHPQDFHEVEDLI
  KTAIGNTLVQDICYSPDTQKLLVRLSDVYNRSFLENLKVNTENLLQVENTGKVKGLILTLKGEPGGQTQA
  FDFYSRYFAPWVGVAEDPVTGSAHAVLSSYWSQHLGKKEMHAFQCSHRGGELGISLRPDGRVDIRGGAAV
  VLEGTLTA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_071412
• RefSeq Size: 2587
• RefSeq ORF: 864
• Synonyms: HEL-S-306; MAWBP; MAWDBP
• Locus ID: 64081
• UniProt ID: P30039, A0A024QZK5
• Cytogenetics: 10q21.3
• Summary: Belongs to the PhzF family. [UniProtKB/Swiss-Prot Function]