PBLD (NM_022129) Human Recombinant Protein

CAT#: TP302328

Recombinant protein of human phenazine biosynthesis-like protein domain containing (PBLD), transcript variant 1

Product Images

Coomassie blue staining of purified PBLD protein (Cat# TP302328). The protein was produced from HEK293T cells transfected with PBLD cDNA clone (Cat# RC202328) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202328 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKLPIFIADAFTARAFRGNPAAVCLLENELDEDMHQKIAREMNLSETAFIRKLHPTDNFAQSSCFGLRWF
  TPASEVPLCGHATLASAAVLFHKIKNMNSTLTFVTLSGELRARRAEDGIVLDLPLYPAHPQDFHEVEDLI
  KTAIGNTLVQDICYSPDTQKLLVRLSDVYNRSFLENLKVNTENLLQVENTGKVKGLILTLKGEPGGQTQA
  FDFYSRYFAPWVGVAEDPVTGSAHAVLSSYWSQHLGKKEMHAFQCSHRGGELGISLRPDGRVDIRGGAAV
  VLEGTLTA
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 31.6 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_071412
• Locus ID: 64081
• UniProt ID: P30039, A0A024QZK5
• Cytogenetics: 10q21.3
• Refseq Size: 2587
• Refseq ORF: 864
• Synonyms: HEL-S-306; MAWBP; MAWDBP