NEIL1 (NM_024608) Human Mass Spec Standard

CAT#: PH302329

NEIL1 MS Standard C13 and N15-labeled recombinant protein (NP_078884)

Product Images

Coomassie blue staining of purified NEIL1 protein (Cat# TP302329). The protein was produced from HEK293T cells transfected with NEIL1 cDNA clone (Cat# RC202329) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202329
• Predicted MW: 43.7 kDa
• Protein Sequence:
  Sequence Link

  >RC202329 representing NM_024608
  Red=Cloning site Green=Tags(s)
  
  MPEGPELHLASQFVNEACRALVFGGCVEKSSVSRNPEVPFESSAYRISASARGKELRLILSPLPGAQPQQ
  EPLALVFRFGMSGSFQLVPREELPRHAHLRFYTAPPGPRLALCFVDIRRFGRWDLGGKWQPGRGPCVLQE
  YQQFRESVLRNLADKAFDRPICEALLDQRFFNGIGNYLRAEILYRLKIPPFEKARSVLEALQQHRPSPEL
  TLSQKIRTKLQNPDLLELCHSVPKEVVQLGGRGYGSESGEEDFAAFRAWLRCYGMPGMSSLQDRHGRTIW
  FQGDPGPLAPKGRKSRKKKSKATQLSPEDRVEDALPPSKAPSRTRRAKRDLPKRTATQRPEGTSLQQDPE
  APTVPKKGRRKGRQAASGHCRPRKVKADIPSLEPEGTSAS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_078884
• RefSeq Size: 1896
• RefSeq ORF: 1170
• Synonyms: FPG1; hFPG1; NEI1
• Locus ID: 79661
• UniProt ID: Q96FI4
• Cytogenetics: 15q24.2
• Summary: This gene is a member of the Nei endonuclease VIII-like gene family which encodes DNA glycosylases. The encoded enzyme participates in the DNA repair pathway by initiating base excision repair by removing damaged bases, primarily oxidized pyrimidines. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2012]
• Protein Families: Druggable Genome
• Protein Pathways: Base excision repair