NEIL1 (NM_024608) Human Recombinant Protein
CAT#: TP302329
Purified recombinant protein of Homo sapiens nei endonuclease VIII-like 1 (E. coli) (NEIL1)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202329 representing NM_024608
Red=Cloning site Green=Tags(s) MPEGPELHLASQFVNEACRALVFGGCVEKSSVSRNPEVPFESSAYRISASARGKELRLILSPLPGAQPQQ EPLALVFRFGMSGSFQLVPREELPRHAHLRFYTAPPGPRLALCFVDIRRFGRWDLGGKWQPGRGPCVLQE YQQFRESVLRNLADKAFDRPICEALLDQRFFNGIGNYLRAEILYRLKIPPFEKARSVLEALQQHRPSPEL TLSQKIRTKLQNPDLLELCHSVPKEVVQLGGRGYGSESGEEDFAAFRAWLRCYGMPGMSSLQDRHGRTIW FQGDPGPLAPKGRKSRKKKSKATQLSPEDRVEDALPPSKAPSRTRRAKRDLPKRTATQRPEGTSLQQDPE APTVPKKGRRKGRQAASGHCRPRKVKADIPSLEPEGTSAS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 43.5 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_078884 |
Locus ID | 79661 |
UniProt ID | Q96FI4 |
Cytogenetics | 15q24.2 |
Refseq Size | 1896 |
Refseq ORF | 1170 |
Synonyms | FPG1; hFPG1; NEI1 |
Summary | This gene is a member of the Nei endonuclease VIII-like gene family which encodes DNA glycosylases. The encoded enzyme participates in the DNA repair pathway by initiating base excision repair by removing damaged bases, primarily oxidized pyrimidines. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2012] |
Protein Families | Druggable Genome |
Protein Pathways | Base excision repair |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411199 | NEIL1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY411199 | Transient overexpression lysate of nei endonuclease VIII-like 1 (E. coli) (NEIL1) |
USD 325.00 |
|
PH302329 | NEIL1 MS Standard C13 and N15-labeled recombinant protein (NP_078884) |
USD 2,055.00 |
|
TP762007 | Purified recombinant protein of Human nei endonuclease VIII-like 1 (E. coli) (NEIL1),Leu186-Ser390, with N-terminal His tag, expressed in E. coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review