NEIL1 (NM_024608) Human Recombinant Protein

CAT#: TP302329

Purified recombinant protein of Homo sapiens nei endonuclease VIII-like 1 (E. coli) (NEIL1)

Product Images

Coomassie blue staining of purified NEIL1 protein (Cat# TP302329). The protein was produced from HEK293T cells transfected with NEIL1 cDNA clone (Cat# RC202329) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202329 representing NM_024608
  Red=Cloning site Green=Tags(s)
  
  MPEGPELHLASQFVNEACRALVFGGCVEKSSVSRNPEVPFESSAYRISASARGKELRLILSPLPGAQPQQ
  EPLALVFRFGMSGSFQLVPREELPRHAHLRFYTAPPGPRLALCFVDIRRFGRWDLGGKWQPGRGPCVLQE
  YQQFRESVLRNLADKAFDRPICEALLDQRFFNGIGNYLRAEILYRLKIPPFEKARSVLEALQQHRPSPEL
  TLSQKIRTKLQNPDLLELCHSVPKEVVQLGGRGYGSESGEEDFAAFRAWLRCYGMPGMSSLQDRHGRTIW
  FQGDPGPLAPKGRKSRKKKSKATQLSPEDRVEDALPPSKAPSRTRRAKRDLPKRTATQRPEGTSLQQDPE
  APTVPKKGRRKGRQAASGHCRPRKVKADIPSLEPEGTSAS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 43.5 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_078884
• Locus ID: 79661
• UniProt ID: Q96FI4
• Cytogenetics: 15q24.2
• Refseq Size: 1896
• Refseq ORF: 1170
• Synonyms: FPG1; hFPG1; NEI1
• Summary: This gene is a member of the Nei endonuclease VIII-like gene family which encodes DNA glycosylases. The encoded enzyme participates in the DNA repair pathway by initiating base excision repair by removing damaged bases, primarily oxidized pyrimidines. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2012]
• Protein Families: Druggable Genome
• Protein Pathways: Base excision repair