CITED1 (NM_004143) Human Mass Spec Standard

CAT#: PH302419

CITED1 MS Standard C13 and N15-labeled recombinant protein (NP_004134)

Product Images

Coomassie blue staining of purified CITED1 protein (Cat# TP302419). The protein was produced from HEK293T cells transfected with CITED1 cDNA clone (Cat# RC202419) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202419
• Predicted MW: 19.9 kDa
• Protein Sequence:
  Sequence Link

  >RC202419 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPTTSRPALDVKGGTSPAKEDANQEMSSVAYSNLAVKDRKAVAILHYPGVASNGTKASGAPTSSSGSPIG
  SPTTTPPTKPPSFNLHPAPHLLASMQLQKLNSQYQGMAAATPGQPGEAGPLQNWDFGAQAGGAESLSPSA
  GAQSPAIIDSDPVDEEVLMSLVVELGLDRANELPELWLGQNEFDFTADFPSSC
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004134
• RefSeq Size: 1251
• RefSeq ORF: 579
• Synonyms: MSG1
• Locus ID: 4435
• UniProt ID: Q99966
• Cytogenetics: Xq13.1
• Summary: This gene encodes a member of the CREB-binding protein/p300-interacting transactivator with Asp/Glu-rich C-terminal domain (CITED) family of proteins. The encoded protein, also known as melanocyte-specific gene 1, may function as a transcriptional coactivator and may play a role in pigmentation of melanocytes. Alternatively spliced transcript variants have been described. [provided by RefSeq, Jan 2009]
• Protein Families: Transcription Factors