CITED1 (NM_001144886) Human Mass Spec Standard
CAT#: PH327378
CITED1 MS Standard C13 and N15-labeled recombinant protein (NP_001138358)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC227378 |
Predicted MW | 19.9 kDa |
Protein Sequence |
>RC227378 protein sequence
Red=Cloning site Green=Tags(s) MPTTSRPALDVKGGTSPAKEDANQEMSSVAYSNLAVKDRKAVAILHYPGVASNGTKASGAPTSSSGSPIG SPTTTPPTKPPSFNLHPAPHLLASMQLQKLNSQYQGMAAATPGQPGEAGPLQNWDFGAQAGGAESLSPSA GAQSPAIIDSDPVDEEVLMSLVVELGLDRANELPELWLGQNEFDFTADFPSSC myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001138358 |
RefSeq Size | 903 |
RefSeq ORF | 579 |
Synonyms | MSG1 |
Locus ID | 4435 |
UniProt ID | Q99966 |
Cytogenetics | Xq13.1 |
Summary | This gene encodes a member of the CREB-binding protein/p300-interacting transactivator with Asp/Glu-rich C-terminal domain (CITED) family of proteins. The encoded protein, also known as melanocyte-specific gene 1, may function as a transcriptional coactivator and may play a role in pigmentation of melanocytes. Alternatively spliced transcript variants have been described. [provided by RefSeq, Jan 2009] |
Protein Families | Transcription Factors |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418187 | CITED1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC428546 | CITED1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC428547 | CITED1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY418187 | Transient overexpression lysate of Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 1 (CITED1), transcript variant 1 |
USD 396.00 |
|
LY428546 | Transient overexpression lysate of Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 1 (CITED1), transcript variant 3 |
USD 396.00 |
|
LY428547 | Transient overexpression lysate of Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 1 (CITED1), transcript variant 4 |
USD 396.00 |
|
PH302419 | CITED1 MS Standard C13 and N15-labeled recombinant protein (NP_004134) |
USD 2,055.00 |
|
PH327383 | CITED1 MS Standard C13 and N15-labeled recombinant protein (NP_001138359) |
USD 2,055.00 |
|
TP302419 | Purified recombinant protein of Homo sapiens Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 1 (CITED1), transcript variant 1 |
USD 823.00 |
|
TP327378 | Purified recombinant protein of Homo sapiens Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 1 (CITED1), transcript variant 3 |
USD 748.00 |
|
TP327383 | Purified recombinant protein of Homo sapiens Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 1 (CITED1), transcript variant 4 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review