CK1 epsilon (CSNK1E) (NM_152221) Human Mass Spec Standard

CAT#: PH302436

CSNK1E MS Standard C13 and N15-labeled recombinant protein (NP_689407)

Product Images

Coomassie blue staining of purified CSNK1E protein (Cat# TP302436). The protein was produced from HEK293T cells transfected with CSNK1E cDNA clone (Cat# RC202436) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202436
• Predicted MW: 47.3 kDa
• Protein Sequence:
  Sequence Link

  >RC202436 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MELRVGNKYRLGRKIGSGSFGDIYLGANIASGEEVAIKLECVKTKHPQLHIESKFYKMMQGGVGIPSIKW
  CGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGLGK
  KGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGS
  LPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFSTYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQ
  GFSYDYVFDWNMLKFGAARNPEDVDRERREHEREERMGQLRGSATRALPPGPPTGATANRLRSAAEPVAS
  TPASRIQPAGNTSPRAISRVDRERKVSMRLHRGAPANVSSSDLTGRQEVSRIPASQTSVPFDHLGK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_689407
• RefSeq Size: 2820
• RefSeq ORF: 1248
• Synonyms: CKIe; CKIepsilon; HCKIE
• Locus ID: 1454
• UniProt ID: P49674, Q5U045
• Cytogenetics: 22q13.1
• Summary: 'The protein encoded by this gene is a serine/threonine protein kinase and a member of the casein kinase I protein family, whose members have been implicated in the control of cytoplasmic and nuclear processes, including DNA replication and repair. The encoded protein is found in the cytoplasm as a monomer and can phosphorylate a variety of proteins, including itself. This protein has been shown to phosphorylate period, a circadian rhythm protein. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Feb 2014]'
• Protein Families: Druggable Genome, Protein Kinase
• Protein Pathways: Circadian rhythm - mammal, Hedgehog signaling pathway, Wnt signaling pathway