CK1 epsilon (CSNK1E) (NM_152221) Human Mass Spec Standard
CAT#: PH302436
CSNK1E MS Standard C13 and N15-labeled recombinant protein (NP_689407)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202436 |
| Predicted MW | 47.3 kDa |
| Protein Sequence |
>RC202436 protein sequence
Red=Cloning site Green=Tags(s) MELRVGNKYRLGRKIGSGSFGDIYLGANIASGEEVAIKLECVKTKHPQLHIESKFYKMMQGGVGIPSIKW CGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGLGK KGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGS LPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFSTYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQ GFSYDYVFDWNMLKFGAARNPEDVDRERREHEREERMGQLRGSATRALPPGPPTGATANRLRSAAEPVAS TPASRIQPAGNTSPRAISRVDRERKVSMRLHRGAPANVSSSDLTGRQEVSRIPASQTSVPFDHLGK myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_689407 |
| RefSeq Size | 2820 |
| RefSeq ORF | 1248 |
| Synonyms | CKIe; CKIepsilon; HCKIE |
| Locus ID | 1454 |
| UniProt ID | P49674, Q5U045 |
| Cytogenetics | 22q13.1 |
| Summary | 'The protein encoded by this gene is a serine/threonine protein kinase and a member of the casein kinase I protein family, whose members have been implicated in the control of cytoplasmic and nuclear processes, including DNA replication and repair. The encoded protein is found in the cytoplasm as a monomer and can phosphorylate a variety of proteins, including itself. This protein has been shown to phosphorylate period, a circadian rhythm protein. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Feb 2014]' |
| Protein Families | Druggable Genome, Protein Kinase |
| Protein Pathways | Circadian rhythm - mammal, Hedgehog signaling pathway, Wnt signaling pathway |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403455 | CSNK1E HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC419672 | CSNK1E HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY403455 | Transient overexpression lysate of casein kinase 1, epsilon (CSNK1E), transcript variant 1 |
USD 436.00 |
|
| LY419672 | Transient overexpression lysate of casein kinase 1, epsilon (CSNK1E), transcript variant 2 |
USD 436.00 |
|
| PH321884 | CSNK1E MS Standard C13 and N15-labeled recombinant protein (NP_001885) |
USD 2,055.00 |
|
| TP302436 | Recombinant protein of human casein kinase 1, epsilon (CSNK1E), transcript variant 1 |
USD 823.00 |
|
| TP321884 | Recombinant protein of human casein kinase 1, epsilon (CSNK1E), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China