CK1 epsilon (CSNK1E) (NM_152221) Human Recombinant Protein

CAT#: TP302436

Recombinant protein of human casein kinase 1, epsilon (CSNK1E), transcript variant 1

Product Images

Coomassie blue staining of purified CSNK1E protein (Cat# TP302436). The protein was produced from HEK293T cells transfected with CSNK1E cDNA clone (Cat# RC202436) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202436 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MELRVGNKYRLGRKIGSGSFGDIYLGANIASGEEVAIKLECVKTKHPQLHIESKFYKMMQGGVGIPSIKW
  CGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGLGK
  KGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGS
  LPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFSTYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQ
  GFSYDYVFDWNMLKFGAARNPEDVDRERREHEREERMGQLRGSATRALPPGPPTGATANRLRSAAEPVAS
  TPASRIQPAGNTSPRAISRVDRERKVSMRLHRGAPANVSSSDLTGRQEVSRIPASQTSVPFDHLGK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 47.1 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_689407
• Locus ID: 1454
• UniProt ID: P49674, Q5U045
• Cytogenetics: 22q13.1
• Refseq Size: 2820
• Refseq ORF: 1248
• Synonyms: CKIe; CKIepsilon; HCKIE
• Summary: The protein encoded by this gene is a serine/threonine protein kinase and a member of the casein kinase I protein family, whose members have been implicated in the control of cytoplasmic and nuclear processes, including DNA replication and repair. The encoded protein is found in the cytoplasm as a monomer and can phosphorylate a variety of proteins, including itself. This protein has been shown to phosphorylate period, a circadian rhythm protein. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Feb 2014]
• Protein Families: Druggable Genome, Protein Kinase
• Protein Pathways: Circadian rhythm - mammal, Hedgehog signaling pathway, Wnt signaling pathway