IL1RA (IL1RN) (NM_173843) Human Mass Spec Standard

CAT#: PH302447

IL1RN MS Standard C13 and N15-labeled recombinant protein (NP_776215)

Product Images

Coomassie blue staining of purified IL1RN protein (Cat# TP302447). The protein was produced from HEK293T cells transfected with IL1RN cDNA clone (Cat# RC202447) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202447
• Predicted MW: 17.9 kDa
• Protein Sequence:
  Sequence Link

  >RC202447 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MALETICRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGG
  KMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSL
  TNMPDEGVMVTKFYFQEDE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_776215
• RefSeq Size: 1973
• RefSeq ORF: 480
• Synonyms: DIRA; ICIL-1RA; IL-1ra; IL-1ra3; IL-1RN; IL1F3; IL1RA; IRAP; MVCD4
• Locus ID: 3557
• UniProt ID: P18510, A0A024R528
• Cytogenetics: 2q14.1
• Summary: 'The protein encoded by this gene is a member of the interleukin 1 cytokine family. This protein inhibits the activities of interleukin 1, alpha (IL1A) and interleukin 1, beta (IL1B), and modulates a variety of interleukin 1 related immune and inflammatory responses, particularly in the acute phase of infection and inflammation. This gene and five other closely related cytokine genes form a gene cluster spanning approximately 400 kb on chromosome 2. A polymorphism of this gene is reported to be associated with increased risk of osteoporotic fractures and gastric cancer. Several alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Aug 2020]'
• Protein Families: Druggable Genome, Secreted Protein