beta Synuclein (SNCB) (NM_003085) Human Mass Spec Standard

CAT#: PH302449

SNCB MS Standard C13 and N15-labeled recombinant protein (NP_003076)

Product Images

Coomassie blue staining of purified SNCB protein (Cat# TP302449). The protein was produced from HEK293T cells transfected with SNCB cDNA clone (Cat# RC202449) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202449
• Predicted MW: 14.3 kDa
• Protein Sequence:
  Sequence Link

  >RC202449 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDVFMKGLSMAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTREGVVQGVASVAEKTKEQASHLGGAV
  FSGAGNIAAATGLVKREEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDPPQEEYQEYEPEA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003076
• RefSeq Size: 1310
• RefSeq ORF: 402
• Synonyms: beta-synuclein; synuclein, beta
• Locus ID: 6620
• UniProt ID: Q16143
• Cytogenetics: 5q35.2
• Summary: 'This gene encodes a member of a small family of proteins that inhibit phospholipase D2 and may function in neuronal plasticity. The encoded protein is abundant in lesions of patients with Alzheimer disease. A mutation in this gene was found in individuals with dementia with Lewy bodies. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015]'