beta Synuclein (SNCB) (NM_003085) Human Recombinant Protein
CAT#: TP302449
Recombinant protein of human synuclein, beta (SNCB), transcript variant 2
View other "SNCB" proteins (7)
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202449 protein sequence
Red=Cloning site Green=Tags(s) MDVFMKGLSMAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTREGVVQGVASVAEKTKEQASHLGGAV FSGAGNIAAATGLVKREEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDPPQEEYQEYEPEA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 14.1 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003076 |
Locus ID | 6620 |
UniProt ID | Q16143 |
Cytogenetics | 5q35.2 |
Refseq Size | 1310 |
Refseq ORF | 402 |
Summary | This gene encodes a member of a small family of proteins that inhibit phospholipase D2 and may function in neuronal plasticity. The encoded protein is abundant in lesions of patients with Alzheimer disease. A mutation in this gene was found in individuals with dementia with Lewy bodies. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401075 | SNCB HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC424365 | SNCB HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY401075 | Transient overexpression lysate of synuclein, beta (SNCB), transcript variant 2 |
USD 396.00 |
|
LY424365 | Transient overexpression lysate of synuclein, beta (SNCB), transcript variant 1 |
USD 396.00 |
|
PH302449 | SNCB MS Standard C13 and N15-labeled recombinant protein (NP_003076) |
USD 2,055.00 |
|
PH315165 | SNCB MS Standard C13 and N15-labeled recombinant protein (NP_001001502) |
USD 2,055.00 |
|
TP315165 | Recombinant protein of human synuclein, beta (SNCB), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review