Optineurin (OPTN) (NM_001008211) Human Mass Spec Standard
CAT#: PH302470
OPTN MS Standard C13 and N15-labeled recombinant protein (NP_001008212)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202470 |
| Predicted MW | 65.9 kDa |
| Protein Sequence |
>RC202470 protein sequence
Red=Cloning site Green=Tags(s) MSHQPLSCLTEKEDSPSESTGNGPPHLAHPNLDTFTPEELLQQMKELLTENHQLKEAMKLNNQAMKGRFE ELSAWTEKQKEERQFFEIQSKEAKERLMALSHENEKLKEELGKLKGKSERSSEDPTDDSRLPRAEAEQEK DQLRTQVVRLQAEKADLLGIVSELQLKLNSSGSSEDSFVEIRMAEGEAEGSVKEIKHSPGPTRTVSTGTA LSKYRSRSADGAKNYFEHEELTVSQLLLCLREGNQKVERLEVALKEAKERVSDFEKKTSNRSEIETQTEG STEKENDEEKGPETVGSEVEALNLQVTSLFKELQEAHTKLSEAELMKKRLQEKCQALERKNSAIPSELNE KQELVYTNKKLELQVESMLSEIKMEQAKTEDEKSKLTVLQMTHNKLLQEHNNALKTIEELTRKESEKVDR AVLKELSEKLELAEKALASKQLQMDEMKQTIAKQEEDLETMTILRAQMEVYCSDFHAERAAREKIHEEKE QLALQLAVLLKENDAFEDGGRQSLMEMQSRHGARTSDSDQQAYLVQRGAEDRDWRQQRNIPIHSCPKCGE VLPDIDTLQIHVMDCII myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_001008212 |
| RefSeq Size | 3597 |
| RefSeq ORF | 1731 |
| Synonyms | ALS12; FIP2; GLC1E; HIP7; HYPL; NRP; TFIIIA-INTP |
| Locus ID | 10133 |
| UniProt ID | Q96CV9 |
| Cytogenetics | 10p13 |
| Summary | This gene encodes the coiled-coil containing protein optineurin. Optineurin may play a role in normal-tension glaucoma and adult-onset primary open angle glaucoma. Optineurin interacts with adenovirus E3-14.7K protein and may utilize tumor necrosis factor-alpha or Fas-ligand pathways to mediate apoptosis, inflammation or vasoconstriction. Optineurin may also function in cellular morphogenesis and membrane trafficking, vesicle trafficking, and transcription activation through its interactions with the RAB8, huntingtin, and transcription factor IIIA proteins. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411824 | OPTN HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC423390 | OPTN HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC423391 | OPTN HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC423392 | OPTN HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC425228 | OPTN HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC425229 | OPTN HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC429664 | OPTN HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY411824 | Transient overexpression lysate of optineurin (OPTN), transcript variant 2 |
USD 436.00 |
|
| LY423390 | Transient overexpression lysate of optineurin (OPTN), transcript variant 1 |
USD 436.00 |
|
| LY423391 | Transient overexpression lysate of optineurin (OPTN), transcript variant 3 |
USD 665.00 |
|
| LY423392 | Transient overexpression lysate of optineurin (OPTN), transcript variant 4 |
USD 665.00 |
|
| LY425228 | Transient overexpression lysate of optineurin (OPTN), transcript variant 3 |
USD 396.00 |
|
| LY425229 | Transient overexpression lysate of optineurin (OPTN), transcript variant 4 |
USD 396.00 |
|
| LY429664 | Transient overexpression lysate of optineurin (OPTN), transcript variant 2 |
USD 396.00 |
|
| TP302470 | Recombinant protein of human optineurin (OPTN), transcript variant 1 |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China