UBE2D4 (NM_015983) Human Mass Spec Standard

CAT#: PH302473

UBE2D4 MS Standard C13 and N15-labeled recombinant protein (NP_057067)

Product Images

Coomassie blue staining of purified UBE2D4 protein (Cat# TP302473). The protein was produced from HEK293T cells transfected with UBE2D4 cDNA clone (Cat# RC202473) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202473
• Predicted MW: 16.5 kDa
• Protein Sequence:
  Sequence Link

  >RC202473 representing NM_015983
  Red=Cloning site Green=Tags(s)
  
  MAVKRIQKELTDLQRDPPAQCSAGPVGDDLFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFT
  TKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPEIAHTYKADREKYNRLARE
  WTQKYAM
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057067
• RefSeq Size: 1398
• RefSeq ORF: 441
• Synonyms: HBUCE1
• Locus ID: 51619
• UniProt ID: Q9Y2X8, A0A024RA90
• Cytogenetics: 7p13
• Summary: Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro able to promote polyubiquitination using all 7 ubiquitin Lys residues, but may prefer 'Lys-11' and 'Lys-48'-linked polyubiquitination. [UniProtKB/Swiss-Prot Function]
• Protein Pathways: Ubiquitin mediated proteolysis