NDUF3 (NDUFAF3) (NM_199074) Human Mass Spec Standard
CAT#: PH302480
NDUFAF3 MS Standard C13 and N15-labeled recombinant protein (NP_951056)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202480 |
Predicted MW | 20.4 kDa |
Protein Sequence |
>RC202480 protein sequence
Red=Cloning site Green=Tags(s) MATALALRSLYRARPSLRCPPVELPWAPRRGHRLSPADDELYQRTRISLLQREAAQAMYIDSYNSRGFMI NGNRVLGPCALLPHSVVQWNVGSHQDITEDSFSLFWLLEPRIEIVVVGTGDRTERLQSQVLQAMRQRGIA VEVQDTPNACATFNFLCHEGRVTGAALIPPPGGTSLTSLGQAAQ myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_951056 |
RefSeq Size | 902 |
RefSeq ORF | 555 |
Synonyms | 2P1; C3orf60; E3-3; MC1DN18 |
Locus ID | 25915 |
UniProt ID | A4FU71 |
Cytogenetics | 3p21.31 |
Summary | This gene encodes a mitochondrial complex I assembly protein that interacts with complex I subunits. Mutations in this gene cause mitochondrial complex I deficiency, a fatal neonatal disorder of the oxidative phosphorylation system. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2009] |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404729 | NDUFAF3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC404730 | NDUFAF3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC404732 | NDUFAF3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC404733 | NDUFAF3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC430788 | NDUFAF3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC430789 | NDUFAF3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC430790 | NDUFAF3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY404729 | Transient overexpression lysate of NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 3 (NDUFAF3), nuclear gene encoding mitochondrial protein, transcript variant 1 |
USD 396.00 |
|
LY404730 | Transient overexpression lysate of NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 3 (NDUFAF3), nuclear gene encoding mitochondrial protein, transcript variant 2 |
USD 396.00 |
|
LY404732 | Transient overexpression lysate of NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 3 (NDUFAF3), nuclear gene encoding mitochondrial protein, transcript variant 3 |
USD 396.00 |
|
LY404733 | Transient overexpression lysate of NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 3 (NDUFAF3), nuclear gene encoding mitochondrial protein, transcript variant 4 |
USD 396.00 |
|
LY430788 | Transient overexpression lysate of NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 3 (NDUFAF3), nuclear gene encoding mitochondrial protein, transcript variant 2 |
USD 396.00 |
|
LY430789 | Transient overexpression lysate of NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 3 (NDUFAF3), nuclear gene encoding mitochondrial protein, transcript variant 3 |
USD 396.00 |
|
LY430790 | Transient overexpression lysate of NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 3 (NDUFAF3), nuclear gene encoding mitochondrial protein, transcript variant 4 |
USD 396.00 |
|
PH310699 | NDUFAF3 MS Standard C13 and N15-labeled recombinant protein (NP_951032) |
USD 2,055.00 |
|
PH317632 | NDUFAF3 MS Standard C13 and N15-labeled recombinant protein (NP_951033) |
USD 2,055.00 |
|
PH317754 | NDUFAF3 MS Standard C13 and N15-labeled recombinant protein (NP_951047) |
USD 2,055.00 |
|
TP302480 | Purified recombinant protein of Homo sapiens chromosome 3 open reading frame 60 (C3orf60), transcript variant 4 |
USD 823.00 |
|
TP310699 | Recombinant protein of human chromosome 3 open reading frame 60 (C3orf60), transcript variant 1 |
USD 823.00 |
|
TP317632 | Purified recombinant protein of Homo sapiens chromosome 3 open reading frame 60 (C3orf60), transcript variant 2 |
USD 748.00 |
|
TP317754 | Purified recombinant protein of Homo sapiens chromosome 3 open reading frame 60 (C3orf60), transcript variant 3 |
USD 748.00 |
|
TP318529 | Recombinant protein of human chromosome 3 open reading frame 60 (C3orf60), transcript variant 5 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review