NDUF3 (NDUFAF3) (NM_199069) Human Recombinant Protein

CAT#: TP310699

Recombinant protein of human chromosome 3 open reading frame 60 (C3orf60), transcript variant 1

Product Images

Coomassie blue staining of purified NDUFAF3 protein (Cat# TP310699). The protein was produced from HEK293T cells transfected with NDUFAF3 cDNA clone (Cat# RC210699) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC210699 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MYIDSYNSRGFMINGNRVLGPCALLPHSVVQWNVGSHQDITEDSFSLFWLLEPRIEIVVVGTGDRTERLQ
  SQVLQAMRQRGIAVEVQDTPNACATFNFLCHEGRVTGAALIPPPGGTSLTSLGQAAQ
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 20.2 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_951032
• Locus ID: 25915
• UniProt ID: Q9BU61, Q9Y3Z0
• Cytogenetics: 3p21.31
• Refseq Size: 1387
• Refseq ORF: 381
• Synonyms: 2P1; C3orf60; E3-3; MC1DN18
• Summary: This gene encodes a mitochondrial complex I assembly protein that interacts with complex I subunits. Mutations in this gene cause mitochondrial complex I deficiency, a fatal neonatal disorder of the oxidative phosphorylation system. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2009]