NDUF3 (NDUFAF3) (NM_199073) Human Mass Spec Standard

CAT#: PH317754

NDUFAF3 MS Standard C13 and N15-labeled recombinant protein (NP_951047)

Product Images

Coomassie blue staining of purified NDUFAF3 protein (Cat# TP317754). The protein was produced from HEK293T cells transfected with NDUFAF3 cDNA clone (Cat# RC217754) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC217754
• Predicted MW: 20.4 kDa
• Protein Sequence:
  Sequence Link

  >RC217754 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MATALALRSLYRARPSLRCPPVELPWAPRRGHRLSPADDELYQRTRISLLQREAAQAMYIDSYNSRGFMI
  NGNRVLGPCALLPHSVVQWNVGSHQDITEDSFSLFWLLEPRIEIVVVGTGDRTERLQSQVLQAMRQRGIA
  VEVQDTPNACATFNFLCHEGRVTGAALIPPPGGTSLTSLGQAAQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_951047
• RefSeq Size: 1021
• RefSeq ORF: 555
• Synonyms: 2P1; C3orf60; E3-3; MC1DN18
• Locus ID: 25915
• UniProt ID: A4FU71
• Cytogenetics: 3p21.31
• Summary: This gene encodes a mitochondrial complex I assembly protein that interacts with complex I subunits. Mutations in this gene cause mitochondrial complex I deficiency, a fatal neonatal disorder of the oxidative phosphorylation system. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2009]