Germany
Japan
United Kingdom
China
Uteroglobin (SCGB1A1) (NM_003357) Human Mass Spec Standard
CAT#: PH302497
SCGB1A1 MS Standard C13 and N15-labeled recombinant protein (NP_003348)
Product Images
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202497 |
| Predicted MW | 10 kDa |
| Protein Sequence |
>RC202497 protein sequence
Red=Cloning site Green=Tags(s) MKLAVTLTLVTLALCCSSASAEICPSFQRVIETLLMDTPSSYEAAMELFSPDQDMREAGAQLKKLVDTLP QKPRESIIKLMEKIAQSSLCN myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_003348 |
| RefSeq Size | 452 |
| RefSeq ORF | 273 |
| Synonyms | CC10; CC16; CCPBP; CCSP; UGB; UP-1; UP1 |
| Locus ID | 7356 |
| UniProt ID | P11684, A0A0S2Z4R6 |
| Cytogenetics | 11q12.3 |
| Summary | 'This gene encodes a member of the secretoglobin family of small secreted proteins. The encoded protein has been implicated in numerous functions including anti-inflammation, inhibition of phospholipase A2 and the sequestering of hydrophobic ligands. Defects in this gene are associated with a susceptibility to asthma. [provided by RefSeq, May 2010]' |
| Protein Families | Druggable Genome, Secreted Protein |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418739 | SCGB1A1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY418739 | Transient overexpression lysate of secretoglobin, family 1A, member 1 (uteroglobin) (SCGB1A1) |
USD 396.00 |
|
| TP302497 | Recombinant protein of human secretoglobin, family 1A, member 1 (uteroglobin) (SCGB1A1) |
USD 823.00 |
|
| TP723465 | Purified recombinant protein of Human secretoglobin, family 1A, member 1 (uteroglobin) (SCGB1A1). |
USD 240.00 |
{0} Product Review(s)
Be the first one to submit a review