Uteroglobin (SCGB1A1) (NM_003357) Human Recombinant Protein

CAT#: TP302497

Recombinant protein of human secretoglobin, family 1A, member 1 (uteroglobin) (SCGB1A1)

Product Images

Coomassie blue staining of purified SCGB1A1 protein (Cat# TP302497). The protein was produced from HEK293T cells transfected with SCGB1A1 cDNA clone (Cat# RC202497) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202497 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKLAVTLTLVTLALCCSSASAEICPSFQRVIETLLMDTPSSYEAAMELFSPDQDMREAGAQLKKLVDTLP
  QKPRESIIKLMEKIAQSSLCN
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 9.8 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_003348
• Locus ID: 7356
• UniProt ID: P11684, A0A0S2Z4R6
• Cytogenetics: 11q12.3
• Refseq Size: 452
• Refseq ORF: 273
• Synonyms: CC10; CC16; CCPBP; CCSP; UGB; UP-1; UP1
• Summary: This gene encodes a member of the secretoglobin family of small secreted proteins. The encoded protein has been implicated in numerous functions including anti-inflammation, inhibition of phospholipase A2 and the sequestering of hydrophobic ligands. Defects in this gene are associated with a susceptibility to asthma. [provided by RefSeq, May 2010]
• Protein Families: Druggable Genome, Secreted Protein