Uteroglobin (SCGB1A1) (NM_003357) Human Recombinant Protein
CAT#: TP302497
Recombinant protein of human secretoglobin, family 1A, member 1 (uteroglobin) (SCGB1A1)
View other "SCGB1A1" proteins (4)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202497 protein sequence
Red=Cloning site Green=Tags(s) MKLAVTLTLVTLALCCSSASAEICPSFQRVIETLLMDTPSSYEAAMELFSPDQDMREAGAQLKKLVDTLP QKPRESIIKLMEKIAQSSLCN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 9.8 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003348 |
Locus ID | 7356 |
UniProt ID | P11684, A0A0S2Z4R6 |
Cytogenetics | 11q12.3 |
Refseq Size | 452 |
Refseq ORF | 273 |
Synonyms | CC10; CC16; CCPBP; CCSP; UGB; UP-1; UP1 |
Summary | This gene encodes a member of the secretoglobin family of small secreted proteins. The encoded protein has been implicated in numerous functions including anti-inflammation, inhibition of phospholipase A2 and the sequestering of hydrophobic ligands. Defects in this gene are associated with a susceptibility to asthma. [provided by RefSeq, May 2010] |
Protein Families | Druggable Genome, Secreted Protein |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418739 | SCGB1A1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY418739 | Transient overexpression lysate of secretoglobin, family 1A, member 1 (uteroglobin) (SCGB1A1) |
USD 396.00 |
|
PH302497 | SCGB1A1 MS Standard C13 and N15-labeled recombinant protein (NP_003348) |
USD 2,055.00 |
|
TP723465 | Purified recombinant protein of Human secretoglobin, family 1A, member 1 (uteroglobin) (SCGB1A1). |
USD 240.00 |
{0} Product Review(s)
Be the first one to submit a review