FUS2 (NAT6) (NM_012191) Human Mass Spec Standard

CAT#: PH302498

NAT6 MS Standard C13 and N15-labeled recombinant protein (NP_036323)

Product Images

Coomassie blue staining of purified NAA80 protein (Cat# TP302498). The protein was produced from HEK293T cells transfected with NAA80 cDNA clone (Cat# RC202498) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202498
• Predicted MW: 33.8 kDa
• Protein Sequence:
  Sequence Link

  >RC202498 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MQELTLSPGPAKLTPTLDPTHRMELILSTSPAELTLDPACQPKLPLDSTCQPEMTFNPGPTELTLDPEHQ
  PEETPAPSLAELTLEPVHRRPELLDACADLINDQWPRSRTSRLHSLGQSSDAFPLCLMLLSPHPTLEAAP
  VVVGHARLSRVLNQPQSLLVETVVVARALRGRGFGRRLMEGLEVFARARGFRKLHLTTHDQVHFYTHLGY
  QLGEPVQGLVFTSRRLPATLLNAFPTAPSPRPPRKAPNLTAQAAPRGPKGPPLPPPPPLPECLTISPPVP
  SGPPSKSLLETQYQNVRGRPIFWMEKDI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_036323
• RefSeq Size: 1358
• RefSeq ORF: 924
• Synonyms: FUS-2; FUS2; HsNAAA80; NAT6
• Locus ID: 24142
• UniProt ID: Q93015, Q6IAP1
• Cytogenetics: 3p21.31
• Summary: This gene encodes a member of the N-acetyltransferase family. N-acetyltransferases modify proteins by transferring acetyl groups from acetyl CoA to the N-termini of protein substrates. The encoded protein is a cytoplasmic N-acetyltransferase with a substrate specificity for proteins with an N-terminal methionine. This gene is located in the tumor suppressor gene region on chromosome 3p21.3 and the encoded protein may play a role in cancer. Alternatively spliced transcript variants encoding multiple isoforms have been observed. This gene overlaps and is on the same strand as hyaluronoglucosaminidase 3, and some transcripts of each gene share a portion of the first exon. [provided by RefSeq, Jan 2011]
• Protein Pathways: Glycerophospholipid metabolism, Limonene and pinene degradation, Phenylalanine metabolism, Tyrosine metabolism