TACD2 (TACSTD2) (NM_002353) Human Mass Spec Standard

CAT#: PH302519

TACSTD2 MS Standard C13 and N15-labeled recombinant protein (NP_002344)

Product Images

Coomassie blue staining of purified TACSTD2 protein (Cat# TP302519). The protein was produced from HEK293T cells transfected with TACSTD2 cDNA clone (Cat# RC202519) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202519
• Predicted MW: 35.7 kDa
• Protein Sequence:
  Sequence Link

  >RC202519 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MARGPGLAPPPLRLPLLLLVLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLT
  SKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGD
  LSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTS
  QKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAGLIAV
  IVVVVVALVAGMAVLVITNRRKSGKYKKVEIKELGELRKEPSL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002344
• RefSeq Size: 2080
• RefSeq ORF: 969
• Synonyms: EGP-1; EGP1; GA733-1; GA7331; GP50; M1S1; TROP2
• Locus ID: 4070
• UniProt ID: P09758
• Cytogenetics: 1p32.1
• Summary: 'This intronless gene encodes a carcinoma-associated antigen. This antigen is a cell surface receptor that transduces calcium signals. Mutations of this gene have been associated with gelatinous drop-like corneal dystrophy.[provided by RefSeq, Dec 2009]'
• Protein Families: Druggable Genome, Transmembrane