TACD2 (TACSTD2) (NM_002353) Human Recombinant Protein

CAT#: TP302519

Recombinant protein of human tumor-associated calcium signal transducer 2 (TACSTD2)

Product Images

Coomassie blue staining of purified TACSTD2 protein (Cat# TP302519). The protein was produced from HEK293T cells transfected with TACSTD2 cDNA clone (Cat# RC202519) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202519 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MARGPGLAPPPLRLPLLLLVLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLT
  SKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGD
  LSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTS
  QKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAGLIAV
  IVVVVVALVAGMAVLVITNRRKSGKYKKVEIKELGELRKEPSL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 35.5 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_002344
• Locus ID: 4070
• UniProt ID: P09758
• Cytogenetics: 1p32.1
• Refseq Size: 2080
• Refseq ORF: 969
• Synonyms: EGP-1; EGP1; GA733-1; GA7331; GP50; M1S1; TROP2
• Summary: This intronless gene encodes a carcinoma-associated antigen. This antigen is a cell surface receptor that transduces calcium signals. Mutations of this gene have been associated with gelatinous drop-like corneal dystrophy.[provided by RefSeq, Dec 2009]
• Protein Families: Druggable Genome, Transmembrane