HSD17B14 (NM_016246) Human Mass Spec Standard

CAT#: PH302531

HSD17B14 MS Standard C13 and N15-labeled recombinant protein (NP_057330)

Product Images

Coomassie blue staining of purified HSD17B14 protein (Cat# TP302531). The protein was produced from HEK293T cells transfected with HSD17B14 cDNA clone (Cat# RC202531) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202531
• Predicted MW: 28.3 kDa
• Protein Sequence:
  Sequence Link

  >RC202531 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MATGTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVTQEDDVK
  TLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKSQGNVINIS
  SLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRATIREGM
  LAQPLGRMGQPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVDAPDIPS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057330
• RefSeq Size: 1277
• RefSeq ORF: 810
• Synonyms: DHRS10; retSDR3; SDR47C1
• Locus ID: 51171
• UniProt ID: Q9BPX1, A0A140VJH8
• Cytogenetics: 19q13.33
• Summary: 17-beta-hydroxysteroid dehydrogenases, such as HSD17B14, are primarily involved in metabolism of steroids at the C17 position and also of other substrates, such as fatty acids, prostaglandins, and xenobiotics (Lukacik et al., 2007 [PubMed 17067289]). [supplied by OMIM, Jun 2009]
• Protein Families: Druggable Genome