Nck beta (NCK2) (NM_003581) Human Mass Spec Standard

CAT#: PH302557

NCK2 MS Standard C13 and N15-labeled recombinant protein (NP_003572)

Product Images

Coomassie blue staining of purified NCK2 protein (Cat# TP302557). The protein was produced from HEK293T cells transfected with NCK2 cDNA clone (Cat# RC202557) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202557
• Predicted MW: 42.9 kDa
• Protein Sequence:
  Sequence Link

  >RC202557 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTEEVIVIAKWDYTAQQDQELDIKKNERLWLLDDSKTWWRVRNAANRTGYVPSNYVERKNSLKKGSLVKN
  LKDTLGLGKTRRKTSARDASPTPSTDAEYPANGSGADRIYDLNIPAFVKFAYVAEREDELSLVKGSRVTV
  MEKCSDGWWRGSYNGQIGWFPSNYVLEEVDEAAAESPSFLSLRKGASLSNGQGSRVLHVVQTLYPFSSVT
  EEELNFEKGETMEVIEKPENDPEWWKCKNARGQVGLVPKNYVVVLSDGPALHPAHAPQISYTGPSSSGRF
  AGREWYYGNVTRHQAECALNERGVEGDFLIRDSESSPSDFSVSLKASGKNKHFKVQLVDNVYCIGQRRFH
  TMDELVEHYKKAPIFTSEHGEKLYLVRALQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003572
• RefSeq Size: 2517
• RefSeq ORF: 1140
• Synonyms: GRB4; NCKbeta
• Locus ID: 8440
• UniProt ID: O43639, A0A0S2Z4M6
• Cytogenetics: 2q12.2
• Summary: This gene encodes a member of the NCK family of adaptor proteins. The protein contains three SH3 domains and one SH2 domain. The protein has no known catalytic function but has been shown to bind and recruit various proteins involved in the regulation of receptor protein tyrosine kinases. It is through these regulatory activities that this protein is believed to be involved in cytoskeletal reorganization. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome
• Protein Pathways: Axon guidance, ErbB signaling pathway, Pathogenic Escherichia coli infection, T cell receptor signaling pathway