Nck beta (NCK2) (NM_003581) Human Recombinant Protein

CAT#: TP302557

Recombinant protein of human NCK adaptor protein 2 (NCK2), transcript variant 1

Product Images

Coomassie blue staining of purified NCK2 protein (Cat# TP302557). The protein was produced from HEK293T cells transfected with NCK2 cDNA clone (Cat# RC202557) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202557 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTEEVIVIAKWDYTAQQDQELDIKKNERLWLLDDSKTWWRVRNAANRTGYVPSNYVERKNSLKKGSLVKN
  LKDTLGLGKTRRKTSARDASPTPSTDAEYPANGSGADRIYDLNIPAFVKFAYVAEREDELSLVKGSRVTV
  MEKCSDGWWRGSYNGQIGWFPSNYVLEEVDEAAAESPSFLSLRKGASLSNGQGSRVLHVVQTLYPFSSVT
  EEELNFEKGETMEVIEKPENDPEWWKCKNARGQVGLVPKNYVVVLSDGPALHPAHAPQISYTGPSSSGRF
  AGREWYYGNVTRHQAECALNERGVEGDFLIRDSESSPSDFSVSLKASGKNKHFKVQLVDNVYCIGQRRFH
  TMDELVEHYKKAPIFTSEHGEKLYLVRALQ
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 42.7 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_003572
• Locus ID: 8440
• UniProt ID: O43639, A0A0S2Z4M6
• Cytogenetics: 2q12.2
• Refseq Size: 2517
• Refseq ORF: 1140
• Synonyms: GRB4; NCKbeta
• Summary: This gene encodes a member of the NCK family of adaptor proteins. The protein contains three SH3 domains and one SH2 domain. The protein has no known catalytic function but has been shown to bind and recruit various proteins involved in the regulation of receptor protein tyrosine kinases. It is through these regulatory activities that this protein is believed to be involved in cytoskeletal reorganization. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome
• Protein Pathways: Axon guidance, ErbB signaling pathway, Pathogenic Escherichia coli infection, T cell receptor signaling pathway