KREMEN2 (NM_024507) Human Mass Spec Standard
CAT#: PH302558
KREMEN2 MS Standard C13 and N15-labeled recombinant protein (NP_078783)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202558 |
Predicted MW | 44.4 kDa |
Protein Sequence |
>RC202558 protein sequence
Red=Cloning site Green=Tags(s) MGTQALQGFLFLLFLPLLQPRGASAGSLHSPGLSECFQVNGADYRGHQNRTGPRGAGRPCLFWDQTQQHS YSSASDPHGRWGLGAHNFCRNPDGDVQPWCYVAETEEGIYWRYCDIPSCHMPGYLGCFVDSGAPPALSGP SGTSTKLTVQVCLRFCRMKGYQLAGVEAGYACFCGSESDLARGRLAPATDCDQICFGHPGQLCGGDGRLG VYEVSVGSCQGNWTAPQGVIYSPDFPDEYGPDRNCSWALGPPGAALELTFRLFELADPRDRLELRDAASG SLLRAFDGARPPPSGPLRLGTAALLLTFRSDARGHAQGFALTYRGLQDAAEDPEAPEGSAQTPAAPLDGA NVSCSPRPGAPPAAIGGAVCWLREKGPRRWGLPGAPGEAGLCGTNSPEGWPCPAPPGTPRLRVLPRATGL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_078783 |
RefSeq Size | 1989 |
RefSeq ORF | 1260 |
Synonyms | KRM2 |
Locus ID | 79412 |
UniProt ID | Q8NCW0, Q53F67 |
Cytogenetics | 16p13.3 |
Summary | This gene encodes a high-affinity dickkopf homolog 1 (DKK1) transmembrane receptor. A similar protein in mouse functions interacts with with DKK1 to block wingless (WNT)/beta-catenin signaling. The encoded protein forms a ternary membrane complex with DKK1 and the WNT receptor lipoprotein receptor-related protein 6 (LRP6), and induces rapid endocytosis and removal of LRP6 from the plasma membrane. It contains extracellular kringle, WSC, and CUB domains. Alternatively spliced transcript variants encoding distinct isoforms have been observed for this gene. [provided by RefSeq, Dec 2011] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402993 | KREMEN2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY402993 | Transient overexpression lysate of kringle containing transmembrane protein 2 (KREMEN2), transcript variant 2 |
USD 325.00 |
|
TP302558 | Recombinant protein of human kringle containing transmembrane protein 2 (KREMEN2), transcript variant 2 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review