KREMEN2 (NM_024507) Human Recombinant Protein
CAT#: TP302558
Recombinant protein of human kringle containing transmembrane protein 2 (KREMEN2), transcript variant 2
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202558 protein sequence
Red=Cloning site Green=Tags(s) MGTQALQGFLFLLFLPLLQPRGASAGSLHSPGLSECFQVNGADYRGHQNRTGPRGAGRPCLFWDQTQQHS YSSASDPHGRWGLGAHNFCRNPDGDVQPWCYVAETEEGIYWRYCDIPSCHMPGYLGCFVDSGAPPALSGP SGTSTKLTVQVCLRFCRMKGYQLAGVEAGYACFCGSESDLARGRLAPATDCDQICFGHPGQLCGGDGRLG VYEVSVGSCQGNWTAPQGVIYSPDFPDEYGPDRNCSWALGPPGAALELTFRLFELADPRDRLELRDAASG SLLRAFDGARPPPSGPLRLGTAALLLTFRSDARGHAQGFALTYRGLQDAAEDPEAPEGSAQTPAAPLDGA NVSCSPRPGAPPAAIGGAVCWLREKGPRRWGLPGAPGEAGLCGTNSPEGWPCPAPPGTPRLRVLPRATGL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 42.3 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_078783 |
Locus ID | 79412 |
UniProt ID | Q8NCW0, Q53F67 |
Cytogenetics | 16p13.3 |
Refseq Size | 1989 |
Refseq ORF | 1260 |
Synonyms | KRM2 |
Summary | This gene encodes a high-affinity dickkopf homolog 1 (DKK1) transmembrane receptor. A similar protein in mouse functions interacts with with DKK1 to block wingless (WNT)/beta-catenin signaling. The encoded protein forms a ternary membrane complex with DKK1 and the WNT receptor lipoprotein receptor-related protein 6 (LRP6), and induces rapid endocytosis and removal of LRP6 from the plasma membrane. It contains extracellular kringle, WSC, and CUB domains. Alternatively spliced transcript variants encoding distinct isoforms have been observed for this gene. [provided by RefSeq, Dec 2011] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402993 | KREMEN2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY402993 | Transient overexpression lysate of kringle containing transmembrane protein 2 (KREMEN2), transcript variant 2 |
USD 325.00 |
|
PH302558 | KREMEN2 MS Standard C13 and N15-labeled recombinant protein (NP_078783) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review