S100 calcium binding protein A14 (S100A14) (NM_020672) Human Mass Spec Standard

CAT#: PH302590

S100A14 MS Standard C13 and N15-labeled recombinant protein (NP_065723)

Product Images

Coomassie blue staining of purified S100A14 protein (Cat# TP302590). The protein was produced from HEK293T cells transfected with S100A14 cDNA clone (Cat# RC202590) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202590
• Predicted MW: 11.7 kDa
• Protein Sequence:
  Sequence Link

  >RC202590 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGQCRSANAEDAQEFSDVERAIETLIKNFHQYSVEGGKETLTPSELRDLVTQQLPHLMPSNCGLEEKIAN
  LGSCNDSKLEFRSFWELIGEAAKSVKLERPVRGH
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_065723
• RefSeq Size: 1075
• RefSeq ORF: 312
• Synonyms: BCMP84; S100A15
• Locus ID: 57402
• UniProt ID: Q9HCY8
• Cytogenetics: 1q21.3
• Summary: This gene encodes a member of the S100 protein family which contains an EF-hand motif and binds calcium. The gene is located in a cluster of S100 genes on chromosome 1. Levels of the encoded protein have been found to be lower in cancerous tissue and associated with metastasis suggesting a tumor suppressor function (PMID: 19956863, 19351828). [provided by RefSeq, Dec 2011]