S100 calcium binding protein A14 (S100A14) (NM_020672) Human Recombinant Protein

CAT#: TP302590

Recombinant protein of human S100 calcium binding protein A14 (S100A14)

Product Images

Coomassie blue staining of purified S100A14 protein (Cat# TP302590). The protein was produced from HEK293T cells transfected with S100A14 cDNA clone (Cat# RC202590) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202590 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGQCRSANAEDAQEFSDVERAIETLIKNFHQYSVEGGKETLTPSELRDLVTQQLPHLMPSNCGLEEKIAN
  LGSCNDSKLEFRSFWELIGEAAKSVKLERPVRGH
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 11.5 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_065723
• Locus ID: 57402
• UniProt ID: Q9HCY8
• Cytogenetics: 1q21.3
• Refseq Size: 1075
• Refseq ORF: 312
• Synonyms: BCMP84; S100A15
• Summary: This gene encodes a member of the S100 protein family which contains an EF-hand motif and binds calcium. The gene is located in a cluster of S100 genes on chromosome 1. Levels of the encoded protein have been found to be lower in cancerous tissue and associated with metastasis suggesting a tumor suppressor function (PMID: 19956863, 19351828). [provided by RefSeq, Dec 2011]