SUSD4 (NM_001037175) Human Mass Spec Standard

CAT#: PH302622

SUSD4 MS Standard C13 and N15-labeled recombinant protein (NP_001032252)

Product Images

Coomassie blue staining of purified SUSD4 protein (Cat# TP302622). The protein was produced from HEK293T cells transfected with SUSD4 cDNA clone (Cat# RC202622) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202622
• Predicted MW: 32.2 kDa
• Protein Sequence:
  Sequence Link

  >RC202622 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MYHGMNPSNGDGFLEQQQQQQQPQSPQRLLAVILWFQLALCFGPAQLTGGFDDLQVCADPGIPENGFRTP
  SGGVFFEGSVARFHCQDGFKLKGATKRLCLKHFNGTLGWIPSDNSICVQEDCRIPQIEDAEIHNKTYRHG
  EKLIITCHEGFKIRYPDLHNMVSLCRDDGTWNNLPICQGCLRPLASSNGYVNISELQTSFPVGTVISYRC
  FPGFKLDGSAYLECLQNLIWSSSPPRCLALEGGRPEHLFPVLYFPHIRLAAAVLYFCPVLKSSPTPAPTC
  SSTSTTTSLF
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001032252
• RefSeq Size: 1114
• RefSeq ORF: 870
• Synonyms: PRO222
• Locus ID: 55061
• UniProt ID: Q5VX71, A0A140VK55
• Cytogenetics: 1q41
• Protein Families: Transmembrane