SUSD4 (NM_001037175) Human Recombinant Protein

CAT#: TP302622

Recombinant protein of human sushi domain containing 4 (SUSD4), transcript variant 2

Product Images

Coomassie blue staining of purified SUSD4 protein (Cat# TP302622). The protein was produced from HEK293T cells transfected with SUSD4 cDNA clone (Cat# RC202622) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202622 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MYHGMNPSNGDGFLEQQQQQQQPQSPQRLLAVILWFQLALCFGPAQLTGGFDDLQVCADPGIPENGFRTP
  SGGVFFEGSVARFHCQDGFKLKGATKRLCLKHFNGTLGWIPSDNSICVQEDCRIPQIEDAEIHNKTYRHG
  EKLIITCHEGFKIRYPDLHNMVSLCRDDGTWNNLPICQGCLRPLASSNGYVNISELQTSFPVGTVISYRC
  FPGFKLDGSAYLECLQNLIWSSSPPRCLALEGGRPEHLFPVLYFPHIRLAAAVLYFCPVLKSSPTPAPTC
  SSTSTTTSLF
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 32 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001032252
• Locus ID: 55061
• UniProt ID: Q5VX71, A0A140VK55
• Cytogenetics: 1q41
• Refseq Size: 1114
• Refseq ORF: 870
• Synonyms: PRO222
• Summary: Acts as complement inhibitor by disrupting the formation of the classical C3 convertase. Isoform 3 inhibits the classical complement pathway, while membrane-bound isoform 1 inhibits deposition of C3b via both the classical and alternative complement pathways.[UniProtKB/Swiss-Prot Function]
• Protein Families: Transmembrane