MAP3K12 binding inhibitory protein 1 (MBIP) (NM_016586) Human Mass Spec Standard

CAT#: PH302668

MBIP MS Standard C13 and N15-labeled recombinant protein (NP_057670)

Product Images

Coomassie blue staining of purified MBIP protein (Cat# TP302668). The protein was produced from HEK293T cells transfected with MBIP cDNA clone (Cat# RC202668) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202668
• Predicted MW: 39.3 kDa
• Protein Sequence:
  Sequence Link

  >RC202668 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAATEHNRPSSGDRNLERRCSPNLSREVLYEIFRSLHTLVGQLDLRDDVVKITIDWNKLQSLSAFQPAL
  LFSALEQHILYLQPFLAKLQSPIKEENTTAVEEIGRTEMGNKNEVNDKFSIGDLQEEEKHKESDLRDVKK
  TQIHFDPEVVQIKAGKAEIDRRISAFIERKQAEINENNVREFCNVIDCNQENSCARTDAIFTPYPGFKSH
  VKVSRVVYTYGPQTRPEGIPGSGHKPNSMLRDCGNQAVEERLQNIEAHLRLQTGGPVPRDIYQRIKKLED
  KILELEGISPEYFQSVSFSGKRRKVQPPQQNYSLAELDEKISALKQALLRKSREAESMATHHLP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057670
• RefSeq Size: 1661
• RefSeq ORF: 1032
• Synonyms: MAP3K12 binding inhibitory protein 1; MUK-binding inhibitory protein; OTTHUMP00000178844
• Locus ID: 51562
• UniProt ID: Q9NS73, B2RCV0
• Cytogenetics: 14q13.3