MAP3K12 binding inhibitory protein 1 (MBIP) (NM_016586) Human Recombinant Protein

CAT#: TP302668

Recombinant protein of human MAP3K12 binding inhibitory protein 1 (MBIP), transcript variant 1

Product Images

Coomassie blue staining of purified MBIP protein (Cat# TP302668). The protein was produced from HEK293T cells transfected with MBIP cDNA clone (Cat# RC202668) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202668 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAATEHNRPSSGDRNLERRCSPNLSREVLYEIFRSLHTLVGQLDLRDDVVKITIDWNKLQSLSAFQPAL
  LFSALEQHILYLQPFLAKLQSPIKEENTTAVEEIGRTEMGNKNEVNDKFSIGDLQEEEKHKESDLRDVKK
  TQIHFDPEVVQIKAGKAEIDRRISAFIERKQAEINENNVREFCNVIDCNQENSCARTDAIFTPYPGFKSH
  VKVSRVVYTYGPQTRPEGIPGSGHKPNSMLRDCGNQAVEERLQNIEAHLRLQTGGPVPRDIYQRIKKLED
  KILELEGISPEYFQSVSFSGKRRKVQPPQQNYSLAELDEKISALKQALLRKSREAESMATHHLP
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 39.1 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_057670
• Locus ID: 51562
• UniProt ID: Q9NS73, B2RCV0
• Cytogenetics: 14q13.3
• Refseq Size: 1661
• Refseq ORF: 1032
• Summary: Inhibits the MAP3K12 activity to induce the activation of the JNK/SAPK pathway. Component of the ATAC complex, a complex with histone acetyltransferase activity on histones H3 and H4.[UniProtKB/Swiss-Prot Function]