FKBP14 (NM_017946) Human Mass Spec Standard

CAT#: PH302674

FKBP14 MS Standard C13 and N15-labeled recombinant protein (NP_060416)

Product Images

Coomassie blue staining of purified FKBP14 protein (Cat# TP302674). The protein was produced from HEK293T cells transfected with FKBP14 cDNA clone (Cat# RC202674) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202674
• Predicted MW: 24.2 kDa
• Protein Sequence:
  Sequence Link

  >RC202674 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRLFLWNAVLTLFVTSLIGALIPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDGSLFHSTHKHN
  NGQPIWFTLGILEALKGWDQGLKGMCVGEKRKLIIPPALGYGKEGKGKIPPESTLIFNIDLLEIRNGPRS
  HESFQEMDLNDDWKLSKDEVKAYLKKEFEKHGAVVNESHHDALVEDIFDKEDEDKDGFISAREFTYKHDE
  L
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_060416
• RefSeq Size: 5086
• RefSeq ORF: 633
• Synonyms: EDSKMH; EDSKSCL2; FKBP22; IPBP12
• Locus ID: 55033
• UniProt ID: Q9NWM8, A0A090N7V8
• Cytogenetics: 7p14.3
• Summary: The protein encoded by this gene is a member of the FK506-binding protein family of peptidyl-prolyl cis-trans isomerases. The encoded protein is found in the lumen of the endoplasmic reticulum, where it is thought to accelerate protein folding. Defects in this gene are a cause of a type of Ehlers-Danlos syndrome (EDS). Both a protein-coding variant and noncoding variants are transcribed from this gene. [provided by RefSeq, Mar 2012]
• Protein Families: Druggable Genome