FKBP14 (NM_017946) Human Recombinant Protein

CAT#: TP302674

Recombinant protein of human FK506 binding protein 14, 22 kDa (FKBP14)

Product Images

Coomassie blue staining of purified FKBP14 protein (Cat# TP302674). The protein was produced from HEK293T cells transfected with FKBP14 cDNA clone (Cat# RC202674) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202674 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRLFLWNAVLTLFVTSLIGALIPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDGSLFHSTHKHN
  NGQPIWFTLGILEALKGWDQGLKGMCVGEKRKLIIPPALGYGKEGKGKIPPESTLIFNIDLLEIRNGPRS
  HESFQEMDLNDDWKLSKDEVKAYLKKEFEKHGAVVNESHHDALVEDIFDKEDEDKDGFISAREFTYKHDE
  L
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 24 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_060416
• Locus ID: 55033
• UniProt ID: Q9NWM8, A0A090N7V8
• Cytogenetics: 7p14.3
• Refseq Size: 5086
• Refseq ORF: 633
• Synonyms: EDSKMH; EDSKSCL2; FKBP22; IPBP12
• Summary: The protein encoded by this gene is a member of the FK506-binding protein family of peptidyl-prolyl cis-trans isomerases. The encoded protein is found in the lumen of the endoplasmic reticulum, where it is thought to accelerate protein folding. Defects in this gene are a cause of a type of Ehlers-Danlos syndrome (EDS). Both a protein-coding variant and noncoding variants are transcribed from this gene. [provided by RefSeq, Mar 2012]
• Protein Families: Druggable Genome