FKBP14 (NM_017946) Human Recombinant Protein
CAT#: TP302674
Recombinant protein of human FK506 binding protein 14, 22 kDa (FKBP14)
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC202674 protein sequence
Red=Cloning site Green=Tags(s) MRLFLWNAVLTLFVTSLIGALIPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDGSLFHSTHKHN NGQPIWFTLGILEALKGWDQGLKGMCVGEKRKLIIPPALGYGKEGKGKIPPESTLIFNIDLLEIRNGPRS HESFQEMDLNDDWKLSKDEVKAYLKKEFEKHGAVVNESHHDALVEDIFDKEDEDKDGFISAREFTYKHDE L myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 24 kDa |
| Concentration | >50 ug/mL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_060416 |
| Locus ID | 55033 |
| UniProt ID | Q9NWM8, A0A090N7V8 |
| Cytogenetics | 7p14.3 |
| Refseq Size | 5086 |
| Refseq ORF | 633 |
| Synonyms | EDSKMH; EDSKSCL2; FKBP22; IPBP12 |
| Summary | The protein encoded by this gene is a member of the FK506-binding protein family of peptidyl-prolyl cis-trans isomerases. The encoded protein is found in the lumen of the endoplasmic reticulum, where it is thought to accelerate protein folding. Defects in this gene are a cause of a type of Ehlers-Danlos syndrome (EDS). Both a protein-coding variant and noncoding variants are transcribed from this gene. [provided by RefSeq, Mar 2012] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413430 | FKBP14 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY413430 | Transient overexpression lysate of FK506 binding protein 14, 22 kDa (FKBP14) |
USD 436.00 |
|
| PH302674 | FKBP14 MS Standard C13 and N15-labeled recombinant protein (NP_060416) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China